(data stored in ACNUC7421 zone)

EMBL: CP001600.PE558

CP001600.PE558       Location/Qualifiers
FT   CDS             complement(583757..584458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0600"
FT                   /product="disulfide bond formation protein, DsbB family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67829"
FT                   /db_xref="GOA:C5B755"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR023792"
FT                   /db_xref="UniProtKB/TrEMBL:C5B755"
FT                   /protein_id="ACR67829.1"
FT                   /translation="MSAKMWSDLRQNPVETLVRWQERRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPHFPFGLPLAEWSPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   VPADHTASTPR"
     MSAKMWSDLR QNPVETLVRW QERRFLWLLM ALAMGGLIVL AHAFFQIYLY MAPCEQCVYI        60
     RFAMFVMVIG GLVAAINPRN LALKLFGCIA AFYGAIIGMG YSIKLNGIHH AVHSPDALFG       120
     VQGCSTDPHF PFGLPLAEWS PSWFKPTGDC GYDAPMVPQG VALDSVQQWF IDMYVQAEGW       180
     YLIPSMQFMN MAQACFLAFA LCFAILVIMS VAWAIHLLRR RAVPADHTAS TPR              233
//

If you have problems or comments...

PBIL Back to PBIL home page