(data stored in ACNUC7421 zone)

EMBL: CP001600.PE559

CP001600.PE559       Location/Qualifiers
FT   CDS             complement(584475..585146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0601"
FT                   /product="DsbA-like thioredoxin domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67830"
FT                   /db_xref="GOA:C5B756"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR028588"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5B756"
FT                   /protein_id="ACR67830.1"
FT                   /translation="MHLTLGKTHLKALLSATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSEKVKDVVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRTAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSHADLE
FT                   EGLKDPAVQNTLGEWKASAYDVAKIQGVPAYVVNGKYLLMTKSIKSVDSMADLVKELAA
FT                   K"
     MHLTLGKTHL KALLSATLLT CAFGAAAFSE GTDYVVLEKP IPNAQKTLIK VFSYDCPFCY        60
     KYDKAVTGPV SEKVKDVVRF EPYHLDTKGV YGPQGSEILA VLLNKDRTAG VSIFDDASQF       120
     KKAKFAYYAA YHDKKERWKD GKDPAAFTQT GLDAAGLSHA DLEEGLKDPA VQNTLGEWKA       180
     SAYDVAKIQG VPAYVVNGKY LLMTKSIKSV DSMADLVKEL AAK                         223
//

If you have problems or comments...

PBIL Back to PBIL home page