(data stored in ACNUC7421 zone)

EMBL: CP001600.PE564

CP001600.PE564       Location/Qualifiers
FT   CDS             594948..595853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0606"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67835"
FT                   /db_xref="GOA:C5B761"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C5B761"
FT                   /protein_id="ACR67835.1"
FT                   /translation="MQLQQLVNMFGADLQRRYGEKIHKLTLHGGFSCPNRDGTLGRGGC
FT                   TFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTSTYAEVCILRDMYREA
FT                   LQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQSASEKTLRRINRGHDF
FT                   ACYQRTTRAARARGLKVCSHLIVGLPGETQADCLSTLQRVVETGVEGIKLHPLHIVTGS
FT                   VLAKAWQAGRLQGLTLDRYVHTAGEMIRHTPPEVIYHRISASARRPTLLAPQWCENRWT
FT                   GMVAINNYLLEYGGQASALS"
     MQLQQLVNMF GADLQRRYGE KIHKLTLHGG FSCPNRDGTL GRGGCTFCNV ASFADEQMQR        60
     RSIAEQLEAQ ARKVNRARRY LAYFQAYTST YAEVCILRDM YREALQQADM VGLCVGTRPD       120
     CVPESVLDLL AEYREQGYEV WLELGLQSAS EKTLRRINRG HDFACYQRTT RAARARGLKV       180
     CSHLIVGLPG ETQADCLSTL QRVVETGVEG IKLHPLHIVT GSVLAKAWQA GRLQGLTLDR       240
     YVHTAGEMIR HTPPEVIYHR ISASARRPTL LAPQWCENRW TGMVAINNYL LEYGGQASAL       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page