(data stored in ACNUC7421 zone)

EMBL: CP001600.PE565

CP001600.PE565       Location/Qualifiers
FT   CDS             596042..598378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0607"
FT                   /product="aerobic respiration control sensor protein ArcB,
FT                   putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67836"
FT                   /db_xref="GOA:C5B762"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:C5B762"
FT                   /protein_id="ACR67836.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNIRQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNENGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDQDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQTIDFTGFLTDLENLSGLLVQPKGLSFTLAPDPALPHKVMVDGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSICAPVVEETLSEPLA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGTEALAMFAPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCRRYGKTALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIHRFWDSTPLTVLEDGEPHAHDLCELLDTEMLQQYLDLVGPQLIEQSLAVFERMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQILRDWVVQTNKK"
     MKQIRVLAQY YVDLMVKLGL VRFSILLASA LVLLAMVVQM AVTMLLRGQV DSIDVVRSVF        60
     FGLLITPWAV YFLSVVVEQL EESRQRLSKL VNKLEEMRHR DLKLNQQLKD NIRQLNQEIA       120
     DRVKAEEARL QVLDTLQHEI DQRELAQVEL EQQSALLRSF LDSSPDLVYY RNENGEFSGC       180
     NRAMELLTGK SEKQLIGLTP RDVYDQDIAQ KVIETDEKVF RHNVSLTYEQ WLVYPDGRKA       240
     CFELRKVPFY DRVGKRHGLM GFGRDITERK RYQDALENAS RDKTTFISTI SHELRTPLNG       300
     IVGLSRILLD TELNEEQLKY LKTIHVSAIA LGNIFNDIIE MDKLERRKVQ LDNQTIDFTG       360
     FLTDLENLSG LLVQPKGLSF TLAPDPALPH KVMVDGTRLR QILWNLIGNA VKFTQRGGVS       420
     VRVWREQQDK LLFEVRDTGI GIPPEEQDKI FAMYYQVKDM HGGKPATGTG IGLAVSKRLA       480
     QTMGGDIVVS SVAGEGACFT LSICAPVVEE TLSEPLAEEE MPLPALHVLL VEDIELNVIV       540
     ARSVLEKMGN SVDVAMSGTE ALAMFAPQEY DLVLLDIQLP DMTGLDIART LCRRYGKTAL       600
     PPLVALTANV LKDKKEYLDA GMDDVLSKPL AVPALTAVIH RFWDSTPLTV LEDGEPHAHD       660
     LCELLDTEML QQYLDLVGPQ LIEQSLAVFE RMMPGYLSVL ESNMTARDQK GITEEGHKIK       720
     GAAGSVGLRH LQQLAQQIQT PTLPAWWDNV QEWIDELKQE WRHDVQILRD WVVQTNKK         778
//

If you have problems or comments...

PBIL Back to PBIL home page