(data stored in ACNUC7421 zone)

EMBL: CP001600.PE566

CP001600.PE566       Location/Qualifiers
FT   CDS             598755..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0609"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67837"
FT                   /db_xref="GOA:C5B763"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5B763"
FT                   /protein_id="ACR67837.1"
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRIGAQAVCLAPDREQ
FT                   MQVIDHLHREPVAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAECSIDPALQRLVTSLHRDGKPLGFMCIAPALLPRLLGVPVRVTIGNDAATAAAI
FT                   EAMGGEHVACVVNDIVVDEVQRVVTTPAYMLANTIAEAAEGIDKLVTQVLDMTR"
     MKRVGVVLSG CGVFDGSEIH EAVLTLLALS RIGAQAVCLA PDREQMQVID HLHREPVAER        60
     RNVLVEAARI ARGDVTSLAQ ADASQLDALI VPGGFGAAKN LSSFATDGAE CSIDPALQRL       120
     VTSLHRDGKP LGFMCIAPAL LPRLLGVPVR VTIGNDAATA AAIEAMGGEH VACVVNDIVV       180
     DEVQRVVTTP AYMLANTIAE AAEGIDKLVT QVLDMTR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page