(data stored in ACNUC7421 zone)

EMBL: CP001600.PE568

CP001600.PE568       Location/Qualifiers
FT   CDS             complement(600189..600773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0611"
FT                   /product="Putative phospholipid-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67839"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C5B765"
FT                   /protein_id="ACR67839.1"
FT                   /translation="MRFSLTRCFPALVVLSALLLQGCVAAVIGSATVATQAASDPRSVG
FT                   TQVDDGTLEARISNALSKDAQLKKEARVVVTAYQGQVLLTGQAPSQALISRAKQIAMGV
FT                   EGTKAVYNEVRLGQPVSLGTASADAWITTKVRSQLLASDQVKSTNVKVTTENSEVFLLG
FT                   LVTPKEGQAAAQTASKVSGVKHVTTAFTLLK"
     MRFSLTRCFP ALVVLSALLL QGCVAAVIGS ATVATQAASD PRSVGTQVDD GTLEARISNA        60
     LSKDAQLKKE ARVVVTAYQG QVLLTGQAPS QALISRAKQI AMGVEGTKAV YNEVRLGQPV       120
     SLGTASADAW ITTKVRSQLL ASDQVKSTNV KVTTENSEVF LLGLVTPKEG QAAAQTASKV       180
     SGVKHVTTAF TLLK                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page