(data stored in ACNUC7421 zone)

EMBL: CP001600.PE570

CP001600.PE570       Location/Qualifiers
FT   CDS             complement(601427..601813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0613"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67841"
FT                   /db_xref="GOA:C5B767"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B767"
FT                   /protein_id="ACR67841.1"
FT                   /translation="MAAVPERQHRSGSVTAHQIGAYHEQRARRYLERAGLRFYAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGDAAASIDSRKRQRLQRCAAHWLAVRNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
     MAAVPERQHR SGSVTAHQIG AYHEQRARRY LERAGLRFYA ANVRLRGGEI DLIMRDGATW        60
     VFVEVRYRKT ACYGDAAASI DSRKRQRLQR CAAHWLAVRN QSIETADCRF DVLAITGSQL       120
     QWLPNAFV                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page