(data stored in ACNUC7421 zone)

EMBL: CP001600.PE572

CP001600.PE572       Location/Qualifiers
FT   CDS             603880..604749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0615"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67843"
FT                   /db_xref="GOA:C5B769"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5B769"
FT                   /protein_id="ACR67843.1"
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGVASDRFCYEGFLPAKGKARRDRLRGLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGTDRYVVLARELTKTWESIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADEEVLSPEALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYA
FT                   LAQQSGDK"
     MNQNDHAAIS AATLYVVPTP IGNLGDITQR ALETLKAVDL IAAEDTRHTG MLLQHFAINA        60
     RFFALHDHNE QQKADQLLAK LREGQSIALV SDAGTPLIND PGYHLVRRCR EAGIRVVPLP       120
     GACAAITALS AAGVASDRFC YEGFLPAKGK ARRDRLRGLQ QEARTLIFYE STHRLLESLA       180
     DMVSELGTDR YVVLARELTK TWESIHGAPV AELLAWVQQD ENRRKGEMVL IVEGYQADEE       240
     VLSPEALRTL ALLQAELPLK KAAALAAEIH GVKKNALYKY ALAQQSGDK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page