(data stored in ACNUC7421 zone)

EMBL: CP001600.PE573

CP001600.PE573       Location/Qualifiers
FT   CDS             complement(605188..605868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0617"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67844"
FT                   /db_xref="GOA:C5B770"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:C5B770"
FT                   /protein_id="ACR67844.1"
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVTLMQGASYFSLSHQRARLDQV
FT                   GELAQTLAQQVAARLSPLINDDTPDTKKIAPILDALTRHSRILDVSVYALDGALIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIEGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQTRRSRWQQSSYLLTANVPLEEENERDASVQENTAPTT
FT                   PPKS"
     MVKATLRFRL HRTAIVLICL ALLVTLMQGA SYFSLSHQRA RLDQVGELAQ TLAQQVAARL        60
     SPLINDDTPD TKKIAPILDA LTRHSRILDV SVYALDGALI AQAGERVEVR DRLALDGQRA       120
     GSYFNHQIVQ PIEGRDGPLG FLRLTLDTHV LATESQQVDN TTNLLRLMML LALAIGIILA       180
     RTLLQTRRSR WQQSSYLLTA NVPLEEENER DASVQENTAP TTPPKS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page