(data stored in ACNUC7421 zone)

EMBL: CP001600.PE575

CP001600.PE575       Location/Qualifiers
FT   CDS             607008..608396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0619"
FT                   /product="DNA repair protein RadA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67846"
FT                   /db_xref="GOA:C5B772"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C5B772"
FT                   /protein_id="ACR67846.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPYANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
     MAKAVKRAFV CNECGADYPR WQGQCSACQA WNSISEVRLA AAPAAGRSAR LSGYAGDAGS        60
     LSKVQKLSEI SLEALPRFST GFTEFDRVLG GGVVPGSAIL IGGNPGAGKS TLLLQTLCRL       120
     SQQMKTLYVT GEESLQQVAM RAHRLGLPTE GLNMLSETSI EQICLIAEQE QPKLMVIDSI       180
     QVMHMADIQS SPGSVAQVRE TAAYLTRFAK TRGVAIVMVG HVTKDGSLAG PKVLEHCIDC       240
     SVLLDGDADS RFRTLRSHKN RFGAVNELGV FAMTEQGLRE VSNPSAIFLS RGEEITAGSS       300
     VMVVWEGTRP LLVEIQALVD TSMMSNPRRV AVGLEQNRLA ILLAVLHRHG GLQMADQDVF       360
     VNVVGGVKVS ETSADLALLM SLVSSLRDRP LPQDLVIFGE VGLAGEVRPV ASGQERIIEA       420
     AKHGFRRAIV PYANVPKKAI PNMTVYGVKK LSDALDILQD LA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page