(data stored in ACNUC7421 zone)

EMBL: CP001600.PE576

CP001600.PE576       Location/Qualifiers
FT   CDS             complement(608459..610126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0620"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67847"
FT                   /db_xref="GOA:C5B773"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5B773"
FT                   /protein_id="ACR67847.1"
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGEVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQPDSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEVSGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
     MAQYVYTMNR VGKIVPPKRH ILKDISLSFF PGAKIGVLGL NGAGKSTLLR IMAGVDTDIE        60
     GEARPQPGIK IGYLPQEPKL NLEQTVREAV EEAVGEVKQA LTRLDEVYAL YADPDADFDK       120
     LAKEQGELEA IIQSHDGHNL DNQLERAADA LRLPAWDAKI ANLSGGERRR VAICRLLLEK       180
     PDMLLLDEPT NHLDAESVAW LERFLHDYEG TVVAITHDRY FLDNVAGWIL ELDRGEGIPW       240
     EGNYSSWLEQ KDQRLAQEAS AEAARRKSIE KELEWVRQGA KGRQSKGKAR LARFEELNNT       300
     DYQKRNETSE LFIPPGPRLG DKVLEVSNLS KSYGDRLLID ALSFSIPKGA IVGIIGPNGA       360
     GKSTLFRMIS GQEQPDSGSI TLGDTVTLAS VDQFRDAMDD KKSVWEEVSG GQDIMRIGNF       420
     EIASRAYVGR FNFKGTDQGK RVGELSGGER GRLHLAKLLQ VGGNMLLLDE PTNDLDVETL       480
     RALENALLEF PGCAMVISHD RWFLDRIATH ILDYQDEGRV EFFEGNFSEY EEYKKRTQGA       540
     EALQPHRIKY KKIAK                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page