(data stored in ACNUC7421 zone)

EMBL: CP001600.PE577

CP001600.PE577       Location/Qualifiers
FT   CDS             610507..612435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0621"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67848"
FT                   /db_xref="GOA:C5B774"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:C5B774"
FT                   /protein_id="ACR67848.1"
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDAN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLVFSPQLPQPVAARCNYYYAQYATGHAEVAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWRGAGGLRDQAVLARLRLALEKGNAGLVKYLQQQLPENYRTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGGAFASLARQDADAARAMLPTLVRLQHIPPDKRQEMEE
FT                   IIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNQVQVREWLGRLPKSV
FT                   HDKDEWRYWHAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAARP
FT                   DAALTQEPAIARVRELMYWNMDNTARSEWRALVASKPRPQQEALARYALEQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPGARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKTNIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNSWLGNSAGQIDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPEQILTD
FT                   AEWARRY"
     MVMVGKWRYW SVGLCLALSA AAASADSLDA QRARYQQIKQ AWDANRMDSV NQLMPTLRDY        60
     PLYPYLAYRA LTQDMSQVNA QQIKAFLQQY PTLPPARSLT SRYVNELARR EDWIGLLVFS       120
     PQLPQPVAAR CNYYYAQYAT GHAEVAWRGA QTVWMSGQSL PSSCDKLFDA WRGAGGLRDQ       180
     AVLARLRLAL EKGNAGLVKY LQQQLPENYR TLNTALTALQ ANPRSVEAFA RSVAPSDFTR       240
     DIVGGAFASL ARQDADAARA MLPTLVRLQH IPPDKRQEME EIIAWRLMGS DASADDRRWR       300
     DGVIRRSHNA ALLERRLRMA LGEGNQVQVR EWLGRLPKSV HDKDEWRYWH AVALIDEGKR       360
     SEGQAILRAL IKQRGFYPMV AAQRLGIPYP LQVMRAARPD AALTQEPAIA RVRELMYWNM       420
     DNTARSEWRA LVASKPRPQQ EALARYALEQ GWADLSVQAT IVAKLWDHLQ ERFPLAWPQE       480
     FRSATEDKGI TQSYAMAIAR QESAWNPGAR SSVGASGLMQ LMPKTAEHTA KMFSLSHYQN       540
     SSQLFDPKTN IDIGTRYLEY VYQSLGRNRI LASAAYNAGP SRVNSWLGNS AGQIDAVAFI       600
     ESIPFSETRG YVKNVLAYDA YYRYFMHRPE QILTDAEWAR RY                          642
//

If you have problems or comments...

PBIL Back to PBIL home page