(data stored in ACNUC7421 zone)

EMBL: CP001600.PE58

CP001600.PE58        Location/Qualifiers
FT   CDS             complement(51811..52587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0060"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67320"
FT                   /db_xref="GOA:C5B9E0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9E0"
FT                   /protein_id="ACR67320.1"
FT                   /translation="MPARLSVVLICKNAAELLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYENHDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIVQVLTQPVA
FT                   DRVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYNASQVHESLACSGASVTPLQG
FT                   DLLHLTCRDFAGFQQKQLCYATAWAHERHASGKKTSILGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAIVNAQYTFNKYAELWALQHGYTEKTPL"
     MPARLSVVLI CKNAAELLPE CLASVAWADE IIVLDSGSSD ETQRIAQAAG AKVYENHDWQ        60
     GFGIQRQRAQ QYASGDYILM IDSDERVTPA LKEAIVQVLT QPVADRVYSI ARRNLFLGRF       120
     MRHSGWYPDR VIRLYPRQRY GYNASQVHES LACSGASVTP LQGDLLHLTC RDFAGFQQKQ       180
     LCYATAWAHE RHASGKKTSI LGIFSHTVGA LLKTLLLRGG VLDGKQGWLL AIVNAQYTFN       240
     KYAELWALQH GYTEKTPL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page