(data stored in ACNUC7421 zone)

EMBL: CP001600.PE580

CP001600.PE580       Location/Qualifiers
FT   CDS             613552..614199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0625"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67852"
FT                   /db_xref="GOA:C5B777"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5B777"
FT                   /protein_id="ACR67852.1"
FT                   /translation="MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGERQARQVGTRLGQ
FT                   MGITHVIASDLGRAQQTGEVIAASCRCPLTLDVRLRELSMGVLESRLLASLTLQEEQWR
FT                   LSMLDGSPQGCIPQGETMTQLAERMQQALNDCLTLPQGSRPVLVSHGIALGCLLSTILG
FT                   LPPYAERRLRLRNCSLSRVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR"
     MRQVYLIRHG ETEWNVQRRI QGQSNSPLTV MGERQARQVG TRLGQMGITH VIASDLGRAQ        60
     QTGEVIAASC RCPLTLDVRL RELSMGVLES RLLASLTLQE EQWRLSMLDG SPQGCIPQGE       120
     TMTQLAERMQ QALNDCLTLP QGSRPVLVSH GIALGCLLST ILGLPPYAER RLRLRNCSLS       180
     RVDYQQSAWL ASGWVVETAG DVQHLAQPSM DEVLR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page