(data stored in ACNUC7421 zone)

EMBL: CP001600.PE582

CP001600.PE582       Location/Qualifiers
FT   CDS             615280..615768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0626"
FT                   /product="CreA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67853"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:C5B779"
FT                   /protein_id="ACR67853.1"
FT                   /translation="MNKYFVGLCVALTTLLGSSVHAEEIGSVDTVFKLLGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLIFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
     MNKYFVGLCV ALTTLLGSSV HAEEIGSVDT VFKLLGPDHK IVVEAFDDPD VENVTCYVSR        60
     AKTGGIKGGL GLAEDTSDAA ISCQQVGPIA LSEKIRNKKA DGEVVFRKRT SLIFKKLQVV       120
     RFYDSKRNVL IYLSYSDRVV EGSPKNAISA VPVMPWSAAP QG                          162
//

If you have problems or comments...

PBIL Back to PBIL home page