(data stored in ACNUC7421 zone)

EMBL: CP001600.PE584

CP001600.PE584       Location/Qualifiers
FT   CDS             complement(617674..618378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0628"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67855"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C5B781"
FT                   /protein_id="ACR67855.1"
FT                   /translation="MTQLQFEPIGVIRSPYKEKFAIPRQPGLICDGGGTLDLLPPYNQP
FT                   EAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPANMPVL
FT                   FSPGAQAQIAQRQQDYPHLTRFIRQILAQDPRPAYRRVEEENRVYAVHLLDFNLRWQVK
FT                   NDVCEVLGLDPR"
     MTQLQFEPIG VIRSPYKEKF AIPRQPGLIC DGGGTLDLLP PYNQPEAVRG LEGFSHLWVI        60
     FVFHQTMDGG WRPTVRPPRL GGNARVGVFA TRSTFRPNPI GMSLVELHGI ETRNGVRLQL       120
     GSLDLVDGTP VLDIKPYLPF AESQPQARAG FAQQAPPANM PVLFSPGAQA QIAQRQQDYP       180
     HLTRFIRQIL AQDPRPAYRR VEEENRVYAV HLLDFNLRWQ VKNDVCEVLG LDPR             234
//

If you have problems or comments...

PBIL Back to PBIL home page