(data stored in ACNUC7421 zone)

EMBL: CP001600.PE587

CP001600.PE587       Location/Qualifiers
FT   CDS             complement(619786..620439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0631"
FT                   /product="D-methionine transport system permease protein
FT                   MetI, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67858"
FT                   /db_xref="GOA:C5B784"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B784"
FT                   /protein_id="ACR67858.2"
FT                   /translation="MSEAMMWLMVRGIWETVVMTLVSGFFGFVIGLPIGVLLYTSRPGQ
FT                   ILENAQLYKLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFI
FT                   ARMVENSLLEIPSGLIEAARAMGATPMQIINKILLPEALPGLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
     MSEAMMWLMV RGIWETVVMT LVSGFFGFVI GLPIGVLLYT SRPGQILENA QLYKLLSALV        60
     NIFRSIPFII LLVWMIPFTR LIVGTSIGLQ AALVPLTIGA APFIARMVEN SLLEIPSGLI       120
     EAARAMGATP MQIINKILLP EALPGLINAA TITLITLVGY SAMGGAVGAG GLGQIGYQYG       180
     YIGYNATVMN TVLVLLVVLV YLIQFSGDRI VKAISRK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page