(data stored in ACNUC7421 zone)

EMBL: CP001600.PE588

CP001600.PE588       Location/Qualifiers
FT   CDS             complement(620432..621394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0632"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67859"
FT                   /db_xref="GOA:C5B785"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C5B785"
FT                   /protein_id="ACR67859.1"
FT                   /translation="MSLHVPAGQIYGVIGSSGAGKSTLIRCVNLLERPTQGQVFVDGQD
FT                   LTAMSAGQLTRTRRQIGMIFQHFNLLSSRTVYGNIALPLELDRVPRDEITRRVTELLAL
FT                   VGLADKRDAYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRAILELLKDI
FT                   NRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQGSVGEVFSHPKTPLAQQFIHATL
FT                   HLDIPDDFAARMTPTRGADSQPLLRLEFTGQSVDAPLISQAVRRFNVDINILSSQMDYA
FT                   GGVKFGVMLAEVHGDDTDAQAAIAFFEQHHVKVEVLGYV"
     MSLHVPAGQI YGVIGSSGAG KSTLIRCVNL LERPTQGQVF VDGQDLTAMS AGQLTRTRRQ        60
     IGMIFQHFNL LSSRTVYGNI ALPLELDRVP RDEITRRVTE LLALVGLADK RDAYPANLSG       120
     GQKQRVAIAR ALASNPKVLL CDEATSALDP ATTRAILELL KDINRRLGLT ILLITHEMDV       180
     VKRICDQVAV ISQGKLIEQG SVGEVFSHPK TPLAQQFIHA TLHLDIPDDF AARMTPTRGA       240
     DSQPLLRLEF TGQSVDAPLI SQAVRRFNVD INILSSQMDY AGGVKFGVML AEVHGDDTDA       300
     QAAIAFFEQH HVKVEVLGYV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page