(data stored in ACNUC7421 zone)

EMBL: CP001600.PE590

CP001600.PE590       Location/Qualifiers
FT   CDS             627980..628168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0639"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67862"
FT                   /db_xref="GOA:C5B788"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5B788"
FT                   /protein_id="ACR67862.1"
FT                   /translation="MLHTTNPIIKYKAGLLNLAEELSNVSKACKIMGVSRDTFYRYREL
FT                   ADEGGVDALINHSRACT"
     MLHTTNPIIK YKAGLLNLAE ELSNVSKACK IMGVSRDTFY RYRELADEGG VDALINHSRA        60
     CT                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page