(data stored in ACNUC7421 zone)

EMBL: CP001600.PE595

CP001600.PE595       Location/Qualifiers
FT   CDS             complement(631583..631819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0644"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67867"
FT                   /db_xref="UniProtKB/TrEMBL:C5B793"
FT                   /protein_id="ACR67867.1"
FT                   /translation="MIPRVPNALLASSNIVNPSTHTAPSGIIINTGVTISYDMPWRQVH
FT                   AMLLLALPQTKMRQNGVAPVIRQNECKTQVCQL"
     MIPRVPNALL ASSNIVNPST HTAPSGIIIN TGVTISYDMP WRQVHAMLLL ALPQTKMRQN        60
     GVAPVIRQNE CKTQVCQL                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page