(data stored in ACNUC7421 zone)

EMBL: CP001600.PE598

CP001600.PE598       Location/Qualifiers
FT   CDS             complement(632711..634069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0647"
FT                   /product="phosphatidylserine synthase protein family"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67870"
FT                   /db_xref="GOA:C5B796"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C5B796"
FT                   /protein_id="ACR67870.1"
FT                   /translation="MMLSKFKRAKHQQHLAQLPKLPQQVGEVETLFSPAAFRQALLEAI
FT                   GQATQRIYLVALYLENDDGGRDVLNALYQAKRQRPQLEIFVLVDWHRAQRGRIGAEASN
FT                   TNADWYCRMTNEYPDVIVPIYGVPVNTREALGVLHLKGFVIDDRVIYSGASLNDVYLHR
FT                   HDKYRYDRYHFIRNPRLAAVMCQFVQSTLLGNPAVQRLDRCDRPKSPEIRNETRQFRHA
FT                   LRDSSYQVPAEAGNEELAVTPLAGLGKQNILNKTIHHLICCTERTLTLCTPYFNLPTPL
FT                   VRDIIFLLRQGKQVEIIVGDKKANDFFIPEEEPFKIIGALPYLYEINLRRFISRLQPYL
FT                   DNGQLTVRLWRDDDNTYHLKGMWVDDRWQLITGNNLNPRAWRLDLENAILIHDPQGEIQ
FT                   HQRQHELECIRRHTQVVRSYEDLETIQQYPLKVRKLIRRLRRIRVDRLISRIL"
     MMLSKFKRAK HQQHLAQLPK LPQQVGEVET LFSPAAFRQA LLEAIGQATQ RIYLVALYLE        60
     NDDGGRDVLN ALYQAKRQRP QLEIFVLVDW HRAQRGRIGA EASNTNADWY CRMTNEYPDV       120
     IVPIYGVPVN TREALGVLHL KGFVIDDRVI YSGASLNDVY LHRHDKYRYD RYHFIRNPRL       180
     AAVMCQFVQS TLLGNPAVQR LDRCDRPKSP EIRNETRQFR HALRDSSYQV PAEAGNEELA       240
     VTPLAGLGKQ NILNKTIHHL ICCTERTLTL CTPYFNLPTP LVRDIIFLLR QGKQVEIIVG       300
     DKKANDFFIP EEEPFKIIGA LPYLYEINLR RFISRLQPYL DNGQLTVRLW RDDDNTYHLK       360
     GMWVDDRWQL ITGNNLNPRA WRLDLENAIL IHDPQGEIQH QRQHELECIR RHTQVVRSYE       420
     DLETIQQYPL KVRKLIRRLR RIRVDRLISR IL                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page