(data stored in ACNUC7421 zone)

EMBL: CP001600.PE6

CP001600.PE6         Location/Qualifiers
FT   CDS             7172..8470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0006"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67268"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD0"
FT                   /protein_id="ACR67268.1"
FT                   /translation="MRHPSEVQLTHDARGHQLTNTGVWTPDSHWIAYDVRPHGGSFSGV
FT                   TIERVSVPDGQCEVIYHAGDEACVGVVTVAPTLPERYVFIHGPEHPDAQWQYDFHHRRG
FT                   AIVSADRPGQAETLDALSITAPYLPGALRGGSHVHVFSPDGSRLSFTYNDHVMHEHCPE
FT                   RDQRNIGVALPMGAVRVKKQHPREYDGSHFCVLVSATTPTPRPGSDDITRAYEEGWIGK
FT                   QGYLKEDGQHQRWALAFIGDTLDLDGRRVAELFIVDLPAEMAAYRCAGDQPLQGTLSSL
FT                   PAPPAGICQRRLTFTHQRRHPGLATVPRHWVRSAPDGSAIAFLMRDEQGVVQLWLISPN
FT                   GGEARQITHGAHDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITGRTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWTQIFVARLTSDGE"
     MRHPSEVQLT HDARGHQLTN TGVWTPDSHW IAYDVRPHGG SFSGVTIERV SVPDGQCEVI        60
     YHAGDEACVG VVTVAPTLPE RYVFIHGPEH PDAQWQYDFH HRRGAIVSAD RPGQAETLDA       120
     LSITAPYLPG ALRGGSHVHV FSPDGSRLSF TYNDHVMHEH CPERDQRNIG VALPMGAVRV       180
     KKQHPREYDG SHFCVLVSAT TPTPRPGSDD ITRAYEEGWI GKQGYLKEDG QHQRWALAFI       240
     GDTLDLDGRR VAELFIVDLP AEMAAYRCAG DQPLQGTLSS LPAPPAGICQ RRLTFTHQRR       300
     HPGLATVPRH WVRSAPDGSA IAFLMRDEQG VVQLWLISPN GGEARQITHG AHDVQSAFNW       360
     HPDGRSVLMV MDNSVVRCDV ASGAVTRITG RTAQPPCADA VIPSPDGRWV AYMREVNGWT       420
     QIFVARLTSD GE                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page