(data stored in ACNUC7421 zone)

EMBL: CP001600.PE600

CP001600.PE600       Location/Qualifiers
FT   CDS             complement(636946..637626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0649"
FT                   /product="DTW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67872"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J5"
FT                   /protein_id="ACR67872.1"
FT                   /translation="MSANAVLRLRAARLSQSTRPFHARGCRVQRCLLPQIHCLCDTLTS
FT                   YPAHSRFCLMMYDTEPLKPSNTGRLIADVLPETLAYSWSRTQPDPQLLQLLDDPDYQPY
FT                   VVFPGSYAEPERVVTRVRHNTHRPLFIMLDGTWPEARKMFHKSPYLDRFPVLSINMAQA
FT                   PGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHFRQQYLLGKSHPQVPVA
FT                   ATVE"
     MSANAVLRLR AARLSQSTRP FHARGCRVQR CLLPQIHCLC DTLTSYPAHS RFCLMMYDTE        60
     PLKPSNTGRL IADVLPETLA YSWSRTQPDP QLLQLLDDPD YQPYVVFPGS YAEPERVVTR       120
     VRHNTHRPLF IMLDGTWPEA RKMFHKSPYL DRFPVLSINM AQAPGYLLRE AHRPEQYCTA       180
     EVAAALLALA DDRQASQGLL QHFHHFRQQY LLGKSHPQVP VAATVE                      226
//

If you have problems or comments...

PBIL Back to PBIL home page