(data stored in ACNUC7421 zone)

EMBL: CP001600.PE604

CP001600.PE604       Location/Qualifiers
FT   CDS             640129..640374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0653"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67876"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J9"
FT                   /protein_id="ACR67876.2"
FT                   /translation="MLNIGRDRLFTLQDEHRLPVSVKREYRKTTNSYRRFYRHPNSLKP
FT                   GPGQATTLKPEQVWVADMTYLPLRSGTIYLSLVTDA"
     MLNIGRDRLF TLQDEHRLPV SVKREYRKTT NSYRRFYRHP NSLKPGPGQA TTLKPEQVWV        60
     ADMTYLPLRS GTIYLSLVTD A                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page