(data stored in ACNUC7421 zone)

EMBL: CP001600.PE605

CP001600.PE605       Location/Qualifiers
FT   CDS             640387..640731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0654"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67877"
FT                   /db_xref="GOA:C5B7K0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K0"
FT                   /protein_id="ACR67877.2"
FT                   /translation="MGYHVGEKLQTENVVKAFRQALRRRKTTGPPVHHSDRGVQYCSAL
FT                   YQSIHERNGVTCSMTDGYDCYQNALAERINGILKNTFLPSCPADLAQARTMVKESVDIY
FT                   NHERPHLALK"
     MGYHVGEKLQ TENVVKAFRQ ALRRRKTTGP PVHHSDRGVQ YCSALYQSIH ERNGVTCSMT        60
     DGYDCYQNAL AERINGILKN TFLPSCPADL AQARTMVKES VDIYNHERPH LALK             114
//

If you have problems or comments...

PBIL Back to PBIL home page