(data stored in ACNUC7421 zone)

EMBL: CP001600.PE606

CP001600.PE606       Location/Qualifiers
FT   CDS             complement(640819..641535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0655"
FT                   /product="aerobic respiration control protein ArcA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67878"
FT                   /db_xref="GOA:C5B7K1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K1"
FT                   /protein_id="ACR67878.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
     MQTPHILIVE DELVTRNTLK SIFEAEGYIV HEANDGAEMH QILSEFDINL VIMDINLPGK        60
     NGLLLARELR EQANVALMFL TGRDNEVDKI LGLEIGADDY ITKPFNPREL TIRARNLLSR       120
     TMNLGSGTEE RKSVEHYRFN GWELDINSRS LVSPDGEQYK LPRSEFRAML HFCENPGKIQ       180
     SRAELLKKMT GRELKPHDRT VDVTIRRIRK HFESTPDTPE IIATIHGEGY RFCGDLEE         238
//

If you have problems or comments...

PBIL Back to PBIL home page