(data stored in ACNUC7421 zone)

EMBL: CP001600.PE61

CP001600.PE61        Location/Qualifiers
FT   CDS             complement(55136..56263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0064"
FT                   /product="glucuronic acid transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67324"
FT                   /db_xref="GOA:C5BB89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB89"
FT                   /protein_id="ACR67324.1"
FT                   /translation="MTQFRLALVRQKYRPDGGAERFVSRALEALDSHDIELNVITRQWQ
FT                   GPVKPAWHIHQCNPWKWGRISREHGFARAARTLWQQQRFDLVQSHERIPGCDLYRAGDG
FT                   VHRRWLTQRARILPGWKIHMLWHDRYHRYVMNAEQAMYQAPELRAVICNADMIKQEIIA
FT                   DFGVPESKIHVIYNAIDHHRFLPPDEAQRAALRRRWQIPQSASCLIYVGSGFERKGLRA
FT                   AIEAIAPTGHYLLVVGKDKEEARYRALANTLGCAQRVRFLGMQPETLPFYQMADGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSTGCGGAEFIRSGDNGYVCDALDIAALREAVMALPTQ
FT                   ALGSHAGRLARERVMECTAERLSAQLIGLYRQLVK"
     MTQFRLALVR QKYRPDGGAE RFVSRALEAL DSHDIELNVI TRQWQGPVKP AWHIHQCNPW        60
     KWGRISREHG FARAARTLWQ QQRFDLVQSH ERIPGCDLYR AGDGVHRRWL TQRARILPGW       120
     KIHMLWHDRY HRYVMNAEQA MYQAPELRAV ICNADMIKQE IIADFGVPES KIHVIYNAID       180
     HHRFLPPDEA QRAALRRRWQ IPQSASCLIY VGSGFERKGL RAAIEAIAPT GHYLLVVGKD       240
     KEEARYRALA NTLGCAQRVR FLGMQPETLP FYQMADGLLL PTLYDPFPNV ILEAMACGLP       300
     VITSTGCGGA EFIRSGDNGY VCDALDIAAL REAVMALPTQ ALGSHAGRLA RERVMECTAE       360
     RLSAQLIGLY RQLVK                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page