(data stored in ACNUC7421 zone)

EMBL: CP001600.PE610

CP001600.PE610       Location/Qualifiers
FT   CDS             645724..646653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0660"
FT                   /product="homoserine kinase, putative"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67882"
FT                   /db_xref="GOA:C5B7K5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K5"
FT                   /protein_id="ACR67882.1"
FT                   /translation="MVKIYAPASIGNVSIGFDVLGAAVTPLDGTLLGDCVSIAASSHFS
FT                   LHCHGRFVDSLPSTVQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVV
FT                   AALAALNRFAGEPLDAHRLLMLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQEIISQ
FT                   PVPCFDEWLWVMAYPGIKVSTAEARAILPPHYSRGDCVRHGRHLAGFIHACHTRQPSLA
FT                   AALMQDVIAEPYRCGLLPGFADARRAAGELGALACGISGSGPTLFAVCDDLTAAQAVAQ
FT                   WLAQHYLQNEQGFVHICRLDSAGARQLG"
     MVKIYAPASI GNVSIGFDVL GAAVTPLDGT LLGDCVSIAA SSHFSLHCHG RFVDSLPSTV        60
     QENIVYQCWQ RFCEVTGREL AVEMVLEKNM PIGSGLGSSA CSVVAALAAL NRFAGEPLDA       120
     HRLLMLMGEL EGRISGSVHY DNVAPCYLGG LQLMLEAQEI ISQPVPCFDE WLWVMAYPGI       180
     KVSTAEARAI LPPHYSRGDC VRHGRHLAGF IHACHTRQPS LAAALMQDVI AEPYRCGLLP       240
     GFADARRAAG ELGALACGIS GSGPTLFAVC DDLTAAQAVA QWLAQHYLQN EQGFVHICRL       300
     DSAGARQLG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page