(data stored in ACNUC7421 zone)

EMBL: CP001600.PE612

CP001600.PE612       Location/Qualifiers
FT   CDS             complement(648004..648801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0662"
FT                   /product="Protein of unknown function (DUF328)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67884"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K7"
FT                   /protein_id="ACR67884.1"
FT                   /translation="MLMIISPAKTLDYTSPLAIQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPSFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQINQQLLQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGMMSRFIIQA
FT                   RLREPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
     MLMIISPAKT LDYTSPLAIQ RYTQPQMLAQ AETLMQTVRT LTPAQLGSLM KISDKLAGLN        60
     AARFTEWQPS FTPENARQAI LAFKGDVYTG LQAETFSEQD FDFAQRHLCM LSGLYGVLRP       120
     LDLMMPYRLE MGTRLHTPYG NDLYAFWGDS ITRQINQQLL QQGDRVVVNL ASDEYFKAVR       180
     PAALEGELIK PIFMDEKNGS MKVISFYAKK ARGMMSRFII QARLREPEQL KAFDLEGYAF       240
     AGETQGRQGR ELLFTRRHSA ISPAR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page