(data stored in ACNUC7421 zone)

EMBL: CP001600.PE613

CP001600.PE613       Location/Qualifiers
FT   CDS             complement(648911..649453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0663"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67885"
FT                   /db_xref="GOA:C5B7K8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K8"
FT                   /protein_id="ACR67885.2"
FT                   /translation="MQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRALS
FT                   SAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVMFG
FT                   ALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPRLDLSKYP
FT                   EIQQQVEPGIWEKPTRP"
     MQMLGVFMDT LVICSATAAI ILSSGVLDAA PGTISGIELT QRALSSAVGD WGGIFIAVAI        60
     FFFAFTSIIA NYAYAESNLI FLEHNHPHGL VFLRLCTLGM VMFGALAELP LVWKMADLSM       120
     ALMAITNLIA ILLLSGVAFK LARDYNHQRR LGLLPRLDLS KYPEIQQQVE PGIWEKPTRP       180
//

If you have problems or comments...

PBIL Back to PBIL home page