(data stored in ACNUC7421 zone)

EMBL: CP001600.PE614

CP001600.PE614       Location/Qualifiers
FT   CDS             complement(649341..650351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0664"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67886"
FT                   /db_xref="GOA:C5B7K9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K9"
FT                   /protein_id="ACR67886.1"
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVLKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPVSAAPRLAGLCADAGGLYGYAGYLQRDCRHHPLLRRPGRGAGHHQRH"
     MTDLISFINN ILWGSVLIYL LIGAGLYFTF RTGFIQFRHF GHMFSVLKNS NKADSGGISS        60
     FQALCTSLAA RVGTGNLTGV AIALTAGGPG AIFWMWIIAL IGMATSFIES TLAQLYKTRD       120
     DQGNFRGGPA YYMEKGLGMR WMGILFSLFL LVAFGLVFNA VQANSIAQAT AVAFHIPPLY       180
     VGIALMLMCG VVIFGGLRSI ARTAELVVPV MAIAYLLLAF WVMGHNLARM PEVLLLVLKS       240
     AFGLQEAAAG AIGYGISQAM TQGIQRGLFS NEAGMGSAPN AAASATPYPV SAAPRLAGLC       300
     ADAGGLYGYA GYLQRDCRHH PLLRRPGRGA GHHQRH                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page