(data stored in ACNUC7421 zone)

EMBL: CP001600.PE619

CP001600.PE619       Location/Qualifiers
FT   CDS             654142..654729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0669"
FT                   /product="putative molybdopterin binding domain protein"
FT                   /note="Probable molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67891"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L4"
FT                   /protein_id="ACR67891.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALETWLASALATPYTLESR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTSGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QVSLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDGDGNTVVHGIFASVP
FT                   YCIQLLDGPYVETHPAVIAAFRPKSARRETID"
     MNTLRIGLVS ISDRASSGVY QDLGIPALET WLASALATPY TLESRLIPDE QPLIEQTLCE        60
     LVDERGCHLV LTSGGTGPAR RDVTPDATLA VADREMPGFG EQMRQVSLRF VPTAILSRQV       120
     GVIRKQALII NLPGQPKSIR ETLEGLKDGD GNTVVHGIFA SVPYCIQLLD GPYVETHPAV       180
     IAAFRPKSAR RETID                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page