(data stored in ACNUC7421 zone)

EMBL: CP001600.PE621

CP001600.PE621       Location/Qualifiers
FT   CDS             complement(656250..656753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0671"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67893"
FT                   /db_xref="GOA:C5B7L6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L6"
FT                   /protein_id="ACR67893.1"
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLMEYKKGNTFGLT
FT                   AFTAYGSFWLTLAALLTLPKMGLAEATDALSLGTYLALWGIFTLFMFFGTLRGNRVLQF
FT                   VFASLTVLFFLLAYGNITANASVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
     MLNLHNAGLF PLTSVILAMG IFFGGIAQIL AGLMEYKKGN TFGLTAFTAY GSFWLTLAAL        60
     LTLPKMGLAE ATDALSLGTY LALWGIFTLF MFFGTLRGNR VLQFVFASLT VLFFLLAYGN       120
     ITANASVLHI AGIEGIICGA SAIYLAMAEV INEQYGRDVL PIGAKHA                     167
//

If you have problems or comments...

PBIL Back to PBIL home page