(data stored in ACNUC7421 zone)

EMBL: CP001600.PE622

CP001600.PE622       Location/Qualifiers
FT   CDS             657136..659043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0672"
FT                   /product="chaperone protein DnaK, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67894"
FT                   /db_xref="GOA:C5B7L7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L7"
FT                   /protein_id="ACR67894.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYKIVAADNGDAWVE
FT                   VKDQKIAPPQISAEVLKKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEELVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEEAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
     MGKIIGIDLG TTNSCVAVMD GGKARVLENA EGDRTTPSII AYTQDGEVLV GQPAKRQAVT        60
     NPQNTLFAIK RLIGRRFEDA EAQRDKDIMP YKIVAADNGD AWVEVKDQKI APPQISAEVL       120
     KKMKKTAEDF LGETVTEAVI TVPAYFNDAQ RQATKDAGRI AGLDVKRIIN EPTAAALAYG       180
     MDKGVGNRTI AVYDLGGGTF DISIIEIDDV DGEKTFEVLA TNGDTHLGGE DFDSRLINYL       240
     VDEFKKEQGI DLRNDPLAMQ RLKEAAEKAK IELSSAQQTD VNLPYITADA TGPKHMNIKV       300
     TRAKLESLVE ELVARSMEPL KVALKDAGLS VSDIDDVILV GGQTRMPMVQ KQVADFFGKE       360
     PRKDVNPDEA VAIGAAVQGG VLAGDVKDVL LLDVTPLSLG IETMGGVMTA LISKNTTIPT       420
     KHSQVFSTAE DNQSAVTIHV LQGERKRAAD NKSLGQFNLD GIQPAPRGMP QIEVTFDIDA       480
     DGILHVSAKD KNSGREQNIT IKASSGLSED EIKQMVRDAE ANAEADRKFE ELVQVRNQAD       540
     QLVHGTRKLV EEAGDKLPAT DKSAIEEAVK ALEAASKGED KADIEAKIQA LVQSSAKLQE       600
     LAQQQAQAGE AQADTSAKKD DDVVDAEFEE VKDKK                                  635
//

If you have problems or comments...

PBIL Back to PBIL home page