(data stored in ACNUC7421 zone)

EMBL: CP001600.PE623

CP001600.PE623       Location/Qualifiers
FT   CDS             659154..660287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0673"
FT                   /product="chaperone protein DnaJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67895"
FT                   /db_xref="GOA:C5B7L8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L8"
FT                   /protein_id="ACR67895.1"
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGGGFGGGADFSDIFGDVFGDIF
FT                   GGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLAECDVCHGSGAKKGSEPITCP
FT                   TCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVD
FT                   TGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEI
FT                   EVPTLDGRVNLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQKQ
FT                   LLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
     MAKKDYYEIL GVSREADERE IKKAYKRLAM KYHPDRNQGD KEAEDKFKEI KEAYEILTDA        60
     QKRAAYDQYG HAAFEQGGMG GGGGGFGGGA DFSDIFGDVF GDIFGGGRRQ RAARGADLRY       120
     NMDLTLEEAV RGVTKEIRIP TLAECDVCHG SGAKKGSEPI TCPTCHGAGQ VQMRQGFFTV       180
     QQPCPHCHGR GTIIKDPCNK CHGHGRIEKS KTLSVKIPAG VDTGDRIRLA GEGEAGENGA       240
     PAGDLYVQVQ VKAHPIFERE DNNLFCEVPI NFAMAALGGE IEVPTLDGRV NLKIPAETQT       300
     GKMFRMRGRG VKSVRGGAQG DLLCRVVVET PVNLNDKQKQ LLRELEESFG GPASDKNSPR       360
     SKRFFDGVKK FFDDLTR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page