(data stored in ACNUC7421 zone)

EMBL: CP001600.PE625

CP001600.PE625       Location/Qualifiers
FT   CDS             661903..662805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0675"
FT                   /product="transcriptional activator protein NhaR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67897"
FT                   /db_xref="GOA:C5B7M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M0"
FT                   /protein_id="ACR67897.1"
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
     MRLSHINFNH LYYFWQVCKE GSVVGAAEAL FLTPQTITGQ IKALEERLGG KLFKRQGRGL        60
     VPSELGQLVF RYADRMFMLS QEMLDIVNYR KESSMLFDVG VADALSKRLV SQVLETAVAD       120
     HEQIHLRCFE STHELLLEQL SQHKLDMILS DCPVDSSQQE GLFSVKLGEC GVSFFCRQPL       180
     PEMPFPTCLE QRKLLIPGRR SMLGRKLLNW FNSQGLQVQI LGEFDDAALM KAFGLYHDAI       240
     FVAPSIYAQD MYANVQDNIR EVGRIDNVQE EYYVIFAERM IQHPAVQRVC NKDFSALFSR       300
//

If you have problems or comments...

PBIL Back to PBIL home page