(data stored in ACNUC7421 zone)

EMBL: CP001600.PE626

CP001600.PE626       Location/Qualifiers
FT   CDS             662914..663123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0676"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67898"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M1"
FT                   /protein_id="ACR67898.2"
FT                   /translation="MTSSFILVDQAFVCLTVDDRLHVVVRCLSSCFVASSDSCVYFLDE
FT                   STHHGTAASIVLATLFRLNGAFLS"
     MTSSFILVDQ AFVCLTVDDR LHVVVRCLSS CFVASSDSCV YFLDESTHHG TAASIVLATL        60
     FRLNGAFLS                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page