(data stored in ACNUC7421 zone)

EMBL: CP001600.PE63

CP001600.PE63        Location/Qualifiers
FT   CDS             57470..58441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0066"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67326"
FT                   /db_xref="GOA:C5BB91"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB91"
FT                   /protein_id="ACR67326.1"
FT                   /translation="MSHPGFIITIDTEGDNLWQNHDRITTENARYLPRFQLLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFARDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIRQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLEHGYQIDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDHAYFVDAADLRREGSTALLEVPMSTRLKHDPLFNHLRGA
FT                   YDRLRGKRRPPSVQWLRPRGGNLQEMQRVAEYHLSLGRDYVEFMLHSSEFMPGGSPTFR
FT                   SGQDIERLYHDLEALFDWLAPQVKGQTLAEYYQIKRGQRPAR"
     MSHPGFIITI DTEGDNLWQN HDRITTENAR YLPRFQLLCE KYGFKPVYLT NYEMASDPVY        60
     VEFARDVIAR GCGEVGMHLH AWNSPPEIPL TDNDWANKPY LIEYPAEVIR QKVDYMTHLL       120
     EDTFQTKMVS HRAGRWAMNA FYLQLLLEHG YQIDCSVTPR VDWRGARGAP QGNGGSDYSG       180
     YPDHAYFVDA ADLRREGSTA LLEVPMSTRL KHDPLFNHLR GAYDRLRGKR RPPSVQWLRP       240
     RGGNLQEMQR VAEYHLSLGR DYVEFMLHSS EFMPGGSPTF RSGQDIERLY HDLEALFDWL       300
     APQVKGQTLA EYYQIKRGQR PAR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page