(data stored in ACNUC7421 zone)

EMBL: CP001600.PE633

CP001600.PE633       Location/Qualifiers
FT   CDS             complement(669368..669922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0683"
FT                   /product="conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67905"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M8"
FT                   /protein_id="ACR67905.1"
FT                   /translation="MFTKKALACLLVAGGLSLSAQAMTLSSPSVDNGKSLQNVQIFNGW
FT                   GCTGQNKSPALTWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGE
FT                   KESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYA
FT                   GYFILQHKIGEARLTAPTNMR"
     MFTKKALACL LVAGGLSLSA QAMTLSSPSV DNGKSLQNVQ IFNGWGCTGQ NKSPALTWSD        60
     VPAGTKSFAV TMYDPDAPTG SGWWHWMMID IPASVHSLAQ NVGEKESRDL PKGAIQLRND       120
     FGYNGFGGAC PPPGAKPHNY QITVYALNVA KLDIPAHASP AYAGYFILQH KIGEARLTAP       180
     TNMR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page