(data stored in ACNUC7421 zone)

EMBL: CP001600.PE634

CP001600.PE634       Location/Qualifiers
FT   CDS             complement(670113..670601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0684"
FT                   /product="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /EC_number="1.17.1.4"
FT                   /note="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67906"
FT                   /db_xref="GOA:C5B7M9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M9"
FT                   /protein_id="ACR67906.1"
FT                   /translation="MNVKEWVEIRCQINGKTYQFCVSPAISLLEMLREHGLTSVKQGCC
FT                   VGECGACSVLIDGVATDSCLYLALWADGKQIVTAEGLGRADSLSPIQQAYVDAGAVQCG
FT                   FCTPGLVVATHALLAKPRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQHEEEEQ"
     MNVKEWVEIR CQINGKTYQF CVSPAISLLE MLREHGLTSV KQGCCVGECG ACSVLIDGVA        60
     TDSCLYLALW ADGKQIVTAE GLGRADSLSP IQQAYVDAGA VQCGFCTPGL VVATHALLAK       120
     PRSRPLTHQE IRRGLSGNLC RCTGYQAIVR AVDLCQHEEE EQ                          162
//

If you have problems or comments...

PBIL Back to PBIL home page