(data stored in ACNUC7421 zone)

EMBL: CP001600.PE636

CP001600.PE636       Location/Qualifiers
FT   CDS             complement(671483..673774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0686"
FT                   /product="xanthine dehydrogenase, molybdenum-binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67908"
FT                   /db_xref="GOA:C5B7N1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N1"
FT                   /protein_id="ACR67908.1"
FT                   /translation="MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGN
FT                   VTAIDTREAESMPGVEAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFG
FT                   DGVAIVVARDLLSAERAAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDA
FT                   GEPEVRISTADLQLEGHYETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTV
FT                   AQALGLPWSHVRVIKPYVGGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVAT
FT                   RTRHAFSIDARLGMRRDGQLEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFG
FT                   YCADTVYTNLPAAGAMRGYGAPQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNP
FT                   VNGKTIYSAGLTECLEKGRRLFEWDQRRAECLAQAADAPVRRGIGIACFSYGSNTYPVG
FT                   VEIAGARLLLNQDGTVNLQIGATEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDIT
FT                   AFDPGAFASRQSYVAAPAIRRAAEIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPD
FT                   QVLMSVADVAMQAYYHQEIGAQILAEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRI
FT                   LNLHDSGRILNPQLAEGQVHGGMGMGIGWALFEEMIIDEQSGVVRNPNLLDYKFPTCVD
FT                   LPDLECAFVETVEPQSAYGHKALGEPPIISPGPAIRNAIRMATGVAINALPITPKTLYR
FT                   EFVQAGLIRE"
     MSLGSPLRRV DAEAKVTGQA RYTDDMMMPG MLHACYVRSR IAHGNVTAID TREAESMPGV        60
     EAVFTFHDVP SAPFPTAGHA WSLEPGKRDI ADRHLLTGHV RHFGDGVAIV VARDLLSAER       120
     AAARVQVSYD ALPVITRPQA ALADGAPAIH PGGNLLRHSE IDAGEPEVRI STADLQLEGH       180
     YETPVVQHCH MEGVTCYAYM EQPDHIVIVS STQIPQIVRR TVAQALGLPW SHVRVIKPYV       240
     GGGFGNKQDV LEEPMAAFLT QRLGGKPVKV SLSREECFVA TRTRHAFSID ARLGMRRDGQ       300
     LEGYRLTVLS NTGAYASHGH SIAAAGANKI SYLYPRSAFG YCADTVYTNL PAAGAMRGYG       360
     APQVDFALEC LMDDAAARLD LDPLEVRLRN VARQGDRNPV NGKTIYSAGL TECLEKGRRL       420
     FEWDQRRAEC LAQAADAPVR RGIGIACFSY GSNTYPVGVE IAGARLLLNQ DGTVNLQIGA       480
     TEIGQGSDTV FAQMASETLG IPFKQIRVIS TQDTDITAFD PGAFASRQSY VAAPAIRRAA       540
     EIMRQKILAH AALISHQPEW GLTLCDGNVV MAMQPDQVLM SVADVAMQAY YHQEIGAQIL       600
     AEVSHKTTTN PPAFGCTFVD LSIDIALCQV TINRILNLHD SGRILNPQLA EGQVHGGMGM       660
     GIGWALFEEM IIDEQSGVVR NPNLLDYKFP TCVDLPDLEC AFVETVEPQS AYGHKALGEP       720
     PIISPGPAIR NAIRMATGVA INALPITPKT LYREFVQAGL IRE                         763
//

If you have problems or comments...

PBIL Back to PBIL home page