(data stored in ACNUC7421 zone)

EMBL: CP001600.PE639

CP001600.PE639       Location/Qualifiers
FT   CDS             675503..676660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0689"
FT                   /product="carbamoyl-phosphate synthase, small subunit,
FT                   putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67911"
FT                   /db_xref="GOA:C5B7N4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N4"
FT                   /protein_id="ACR67911.1"
FT                   /translation="MIKSALLVLEDGTQFHGRSIGADGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNAADEESSTVHAQGLIVRDLPPIASNFRCQETLPDYLRR
FT                   HRVVAIADIDTRKLTRLLREKGAMNGCIVTAENGSEPDAALALEKARAFPGLKGMDLAK
FT                   EVTTKEAYRWCQGSWTLSGGLPAPRDDAELPYHVVAYDFGVKRNILRMLVDRGCRLTVV
FT                   PAQTPAQDVLALDPDGIFLSNGPGDPAPCDYAIEAIATFLRGEIPLFGICLGHQLLALA
FT                   SGAQTVKMKFGHHGGNHPVKDLEGDRVMITAQNHGFAVDEATLPTTLRATHKSLFDGSL
FT                   QGIHRTDRPAFSFQGHPEASPGPHDAAPLFDHFMTLIENYRRTAK"
     MIKSALLVLE DGTQFHGRSI GADGSAVGEV VFNTSMTGYQ EILTDPSYSR QIVTLTYPHI        60
     GNVGTNAADE ESSTVHAQGL IVRDLPPIAS NFRCQETLPD YLRRHRVVAI ADIDTRKLTR       120
     LLREKGAMNG CIVTAENGSE PDAALALEKA RAFPGLKGMD LAKEVTTKEA YRWCQGSWTL       180
     SGGLPAPRDD AELPYHVVAY DFGVKRNILR MLVDRGCRLT VVPAQTPAQD VLALDPDGIF       240
     LSNGPGDPAP CDYAIEAIAT FLRGEIPLFG ICLGHQLLAL ASGAQTVKMK FGHHGGNHPV       300
     KDLEGDRVMI TAQNHGFAVD EATLPTTLRA THKSLFDGSL QGIHRTDRPA FSFQGHPEAS       360
     PGPHDAAPLF DHFMTLIENY RRTAK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page