(data stored in ACNUC7421 zone)

EMBL: CP001600.PE64

CP001600.PE64        Location/Qualifiers
FT   CDS             complement(58527..58916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0067"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67327"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB92"
FT                   /protein_id="ACR67327.1"
FT                   /translation="MLTTLAAGTYGIPTITSNINGLPETVRHQQIGFCLTPTLSVEQYA
FT                   NISAASIDFSPQVYDPVQDRLTPPLILSPEQLADSIESLYRNPETYRRLSDGAREYAAV
FT                   SRCFNDLAQTLCQRLLTRADPRPHG"
     MLTTLAAGTY GIPTITSNIN GLPETVRHQQ IGFCLTPTLS VEQYANISAA SIDFSPQVYD        60
     PVQDRLTPPL ILSPEQLADS IESLYRNPET YRRLSDGARE YAAVSRCFND LAQTLCQRLL       120
     TRADPRPHG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page