(data stored in ACNUC7421 zone)

EMBL: CP001600.PE642

CP001600.PE642       Location/Qualifiers
FT   CDS             680890..681357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0692"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67914"
FT                   /db_xref="GOA:C5B7N7"
FT                   /db_xref="InterPro:IPR020914"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N7"
FT                   /protein_id="ACR67914.1"
FT                   /translation="MITLLLQLVQDMLLAAVPALGFAMVFNVPNRALRYCALLGAIGHG
FT                   SRLLLITLGLNIEWASLMAAILIGVIGIQWSRWLLAHPKVFTVAAVIPMFPGIYAYRAM
FT                   IAVVEISRSGYSEPLFASMVTNFLKASFIVGALSIGLSLPGIWLYRKRPGV"
     MITLLLQLVQ DMLLAAVPAL GFAMVFNVPN RALRYCALLG AIGHGSRLLL ITLGLNIEWA        60
     SLMAAILIGV IGIQWSRWLL AHPKVFTVAA VIPMFPGIYA YRAMIAVVEI SRSGYSEPLF       120
     ASMVTNFLKA SFIVGALSIG LSLPGIWLYR KRPGV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page