(data stored in ACNUC7421 zone)

EMBL: CP001600.PE645

CP001600.PE645       Location/Qualifiers
FT   CDS             complement(683064..683441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0695"
FT                   /product="Protein of unknown function (DUF525)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67917"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7P0"
FT                   /protein_id="ACR67917.1"
FT                   /translation="MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQL
FT                   LRRYWLITNGNGRQTEVQGEGVIGEQPLIQPNGEFQYTSGAIIETPCGTMEGHYEMVDH
FT                   QGHTFRIAIPVFRLAIPSLIN"
     MIDAPRIIVQ VQSVYAGSQS LPEEARFVFA YTVTLRNLGR FNVQLLRRYW LITNGNGRQT        60
     EVQGEGVIGE QPLIQPNGEF QYTSGAIIET PCGTMEGHYE MVDHQGHTFR IAIPVFRLAI       120
     PSLIN                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page