(data stored in ACNUC7421 zone)

EMBL: CP001600.PE648

CP001600.PE648       Location/Qualifiers
FT   CDS             complement(685271..686575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0698"
FT                   /product="SurA N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67920"
FT                   /db_xref="GOA:C5B7P3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P3"
FT                   /protein_id="ACR67920.1"
FT                   /translation="MKNWRTLILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGM
FT                   MKSVKLNAQQAGQQLPDDATLRHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIA
FT                   QQNHISMQQLRSRLAADGLDYKTYRDQIRKEMLISEVRNNEVRSRVTILPQEVDALAKQ
FT                   IGSQNSGETAVNLSHILIPLPENPTQQQVSEAQKQAESLIQQLHQGASFAKLAAAYSAD
FT                   PQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQASVS
FT                   VTEVHARHILLRPSPVMSDTQARAKLEALSAQIKSGQITFEQAAKEYSQDPGSAQKGGD
FT                   LGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLDTRQVDRTDEAQKERAYR
FT                   MLFNRKFAEEAQTWLQEQRAAAYVKILGNSANGAQ"
     MKNWRTLILG VALCANTAFA APQVVDKVVA IVDNGVVLES DVDGMMKSVK LNAQQAGQQL        60
     PDDATLRHQI LERLIMDNVQ LQMAKRMGLE ISDSELDNAI NGIAQQNHIS MQQLRSRLAA       120
     DGLDYKTYRD QIRKEMLISE VRNNEVRSRV TILPQEVDAL AKQIGSQNSG ETAVNLSHIL       180
     IPLPENPTQQ QVSEAQKQAE SLIQQLHQGA SFAKLAAAYS ADPQALKGGE MGWGRLQELP       240
     TLFAEALQSA KKGDIVGPIR SGVGFHILRV NDLRGDQASV SVTEVHARHI LLRPSPVMSD       300
     TQARAKLEAL SAQIKSGQIT FEQAAKEYSQ DPGSAQKGGD LGWAVPSMYD PAFRDALMKL       360
     NKGEISQPVH SNFGWHLIQL LDTRQVDRTD EAQKERAYRM LFNRKFAEEA QTWLQEQRAA       420
     AYVKILGNSA NGAQ                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page