(data stored in ACNUC7421 zone)

EMBL: CP001600.PE649

CP001600.PE649       Location/Qualifiers
FT   CDS             complement(686695..689082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0699"
FT                   /product="Organic solvent tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67921"
FT                   /db_xref="GOA:C5B7P4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P4"
FT                   /protein_id="ACR67921.1"
FT                   /translation="MTESLTPRMKKSIPTLIATLVWSALYSQHALASLAEQCLIGVPVY
FT                   DKPLVSGDINSLPVHITADQSEANYPNNALFHGNVDIQQGNSTLTADKVQLDQKAIQGQ
FT                   PNPLRTVTAIGNVHYADSQIRLQGPSAWSNLNNKDTNVWRGDYQFVGRQGRGDADLMKT
FT                   RDANRYTILDNGTFTSCLPGDNSWSIAGSEIIQDRKEQVAEIWNARFKIGPVPVFYSPY
FT                   LQFPTGNKRRSGFLIPSVNYSNGDGIEFTLPWYWNIAPQADATFTPHYMEKRGLQLQNE
FT                   FRYLSEFGMGQVEFDWLGNDRQFQQDRKNQGITGQELEDLKNRDRWLFYWRHSGVLDHW
FT                   RFGVDYTKVSDPYYFTDLSSSYGSSTSGYATQKFTLGYAETNWNATLSTTQFQVFANAG
FT                   DVNAYRTAPQLDLNYYKNDLGPFDFTLYGQAVKFTNDNVYLPGADRYHVEPVLSLPLSN
FT                   RWGSINTEAKLMATHYQQDVPSQGNLTQLKDNVNRVMPEFKIDGKMIFERDATLLSGYT
FT                   QTLEPRAQYLYIPYRDQSDIYSYDATLLQTDYTGLFRDRSYSGLDRIASANQVTTGLTT
FT                   RLYDDEQNERFNASIGQIYYFSPSRTGDETTTIDRHDNTGSLVWAGDSYLKLTDSWGLR
FT                   GGLQYDTRLNSVALGNAVMEYRKDAESVLQLSYRYASPEYITSMLPSYANNTIYNQGIS
FT                   QAGIIGSLPLAERWALVAGYYYDTKAKQSADAIAGLQYNTCCWSMGVTYERKINSWDSA
FT                   TQNSKYDNKFSLKFALRGMNQNYSLGSAEMLRSGILPYQRAF"
     MTESLTPRMK KSIPTLIATL VWSALYSQHA LASLAEQCLI GVPVYDKPLV SGDINSLPVH        60
     ITADQSEANY PNNALFHGNV DIQQGNSTLT ADKVQLDQKA IQGQPNPLRT VTAIGNVHYA       120
     DSQIRLQGPS AWSNLNNKDT NVWRGDYQFV GRQGRGDADL MKTRDANRYT ILDNGTFTSC       180
     LPGDNSWSIA GSEIIQDRKE QVAEIWNARF KIGPVPVFYS PYLQFPTGNK RRSGFLIPSV       240
     NYSNGDGIEF TLPWYWNIAP QADATFTPHY MEKRGLQLQN EFRYLSEFGM GQVEFDWLGN       300
     DRQFQQDRKN QGITGQELED LKNRDRWLFY WRHSGVLDHW RFGVDYTKVS DPYYFTDLSS       360
     SYGSSTSGYA TQKFTLGYAE TNWNATLSTT QFQVFANAGD VNAYRTAPQL DLNYYKNDLG       420
     PFDFTLYGQA VKFTNDNVYL PGADRYHVEP VLSLPLSNRW GSINTEAKLM ATHYQQDVPS       480
     QGNLTQLKDN VNRVMPEFKI DGKMIFERDA TLLSGYTQTL EPRAQYLYIP YRDQSDIYSY       540
     DATLLQTDYT GLFRDRSYSG LDRIASANQV TTGLTTRLYD DEQNERFNAS IGQIYYFSPS       600
     RTGDETTTID RHDNTGSLVW AGDSYLKLTD SWGLRGGLQY DTRLNSVALG NAVMEYRKDA       660
     ESVLQLSYRY ASPEYITSML PSYANNTIYN QGISQAGIIG SLPLAERWAL VAGYYYDTKA       720
     KQSADAIAGL QYNTCCWSMG VTYERKINSW DSATQNSKYD NKFSLKFALR GMNQNYSLGS       780
     AEMLRSGILP YQRAF                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page