(data stored in ACNUC7421 zone)

EMBL: CP001600.PE65

CP001600.PE65        Location/Qualifiers
FT   CDS             complement(59394..60548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0068"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67328"
FT                   /db_xref="GOA:C5BB93"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB93"
FT                   /protein_id="ACR67328.1"
FT                   /translation="MTEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLSE
FT                   KLNDHANSIIFCNRVIQSSPIQIPSFIRKKALWNKIKKINPSHVVIWNQIIPLEYKPES
FT                   IKAIYYDHGAVWEIDKNKKTIAFFQKIDGCICVSQASKKMLENKFKHHCDISVILNRTN
FT                   IKSRDSIADDKKKTFTIGCAARLSPLKALGLIPLIAEETALQGFNFNFIIAGTGEEESA
FT                   LASLIEKKNLNKSVKTIGFLNNLNDFYKHLDIYISTSAHETCSLSCIEAMSFGIPIISA
FT                   NIDGQPEIISNDHTGFCITPTMSMEDYCKKTGMSLPFKKNIYYPENDQIAPPRLLNPKD
FT                   AANKIIEIYLHGVDDYKKNSIHRAKELFDDKNFEESLIKTIRSF"
     MTEKSIVHLV NLRDFGGVER LILDYVINGK EHNWVIINTA NSLSEKLNDH ANSIIFCNRV        60
     IQSSPIQIPS FIRKKALWNK IKKINPSHVV IWNQIIPLEY KPESIKAIYY DHGAVWEIDK       120
     NKKTIAFFQK IDGCICVSQA SKKMLENKFK HHCDISVILN RTNIKSRDSI ADDKKKTFTI       180
     GCAARLSPLK ALGLIPLIAE ETALQGFNFN FIIAGTGEEE SALASLIEKK NLNKSVKTIG       240
     FLNNLNDFYK HLDIYISTSA HETCSLSCIE AMSFGIPIIS ANIDGQPEII SNDHTGFCIT       300
     PTMSMEDYCK KTGMSLPFKK NIYYPENDQI APPRLLNPKD AANKIIEIYL HGVDDYKKNS       360
     IHRAKELFDD KNFEESLIKT IRSF                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page