(data stored in ACNUC7421 zone)

EMBL: CP001600.PE650

CP001600.PE650       Location/Qualifiers
FT   CDS             689240..690061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0700"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67922"
FT                   /db_xref="GOA:C5B7P5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P5"
FT                   /protein_id="ACR67922.1"
FT                   /translation="MRYWGKFVGVLLGLMSGIGFWGVVLGFLIGHMFDKSRAIKRQGYF
FT                   ANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFRE
FT                   GKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELG
FT                   FSHAQFDQFLGMMEGGRQFGGGYHQAGGQQGGFYTPPQGPTLEDACKVLGVASSADATT
FT                   IKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK"
     MRYWGKFVGV LLGLMSGIGF WGVVLGFLIG HMFDKSRAIK RQGYFANQQQ RQGLFFRTTF        60
     QVMGHLTKSK GRVTEADIQV ASMFMDRLNL HGDARLMAQQ AFREGKEPGY PLRERLRELR       120
     SVCFGRIDLI RIFLEIQLQA AFADGQLHPN ERAVLYVIAE ELGFSHAQFD QFLGMMEGGR       180
     QFGGGYHQAG GQQGGFYTPP QGPTLEDACK VLGVASSADA TTIKRAYRKL MSEHHPDKLV       240
     AKGLPPEMME LAKQKAQEIQ AAYDLIKKEK GFK                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page