(data stored in ACNUC7421 zone)

EMBL: CP001600.PE652

CP001600.PE652       Location/Qualifiers
FT   CDS             complement(690845..693697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0702"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67924"
FT                   /db_xref="GOA:C5B7P7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P7"
FT                   /protein_id="ACR67924.1"
FT                   /translation="MGTVVALDARMVTLLFPATGENRLYARNDSPITRVMFNPGDTITT
FT                   HEGWQLCVEEVQEHEGLLTYIGNRCDNGENSVAVREVLLDSRLTFSKPQDRLFAGQIDR
FT                   MDRFALRYRARKYQSEQFRLPCSGLRGMRASLIPHQLHIARDVGQRHAPRVLLADEVGL
FT                   GKTIEAGMIIHQQLLSGRAERVLIVVPETLQHQWLVEMLRRFNLRVALFDDERYAEAAQ
FT                   DSSNPFETEQLVICSLDFVRRSRQRLEQLADASWDLLVVDEAHHLAWSEQAPSREYQVI
FT                   EQLAEQIPGVLLLTATPEQLGQESHFARLRLLDPNRFHDYAQFVAEQLRYRPVADAVTL
FT                   LLNDGHLQQDELNMLCEMVAEQDIEPLLKAANTDGEDSQQARAELVRMLMDRHGTSRVL
FT                   FRNTRQGVKGFPQRTLHQITLPLPAQYQTAIKVSGIMGSKKSVEAQANDMLYPERIYQE
FT                   FEGENATWWNFDPRAEWLLDFLLTQRDEKVLVICAQAATAIHLEQLLREREGIRAAVFH
FT                   QGMSLIERDRAAAYFASQEEGAQVLLCSEIGSEGRNFQFANHLVMFDLPFNPDLLEQRI
FT                   GRLDRIGQARDIQIYVPCLEGTAQSVLIRWYHQGLDAFEHTCPTGRTIYDRYYETLLAF
FT                   LAKPAQLDGFDDFIKTCRTDHDTLKIQLEKGRDRLLEMHSNGGEAAQALAGSIAAQDND
FT                   VNLVNFALNLFDIVGINQEDRSDSLIVLTPSDHMLVPDFPGLPQDGCTVTFDREQALSR
FT                   EDAQFISWEHPLMRNGLDLILSGDTGSSAVSLLKNKALPVGTLLLEAVYVVEAQAPKQL
FT                   QLTRFLPPTPVRMLLDAKGNDLAAQVEFESFNRQLNAVNRHTASKLVNAVQPNVHAMLQ
FT                   SGEALIADQAQALIDAAKREADEALSAELARLESLRAVNPNIRDDELETLEFTRRKVLE
FT                   TLDQAGWRLDALRLIVVSHQ"
     MGTVVALDAR MVTLLFPATG ENRLYARNDS PITRVMFNPG DTITTHEGWQ LCVEEVQEHE        60
     GLLTYIGNRC DNGENSVAVR EVLLDSRLTF SKPQDRLFAG QIDRMDRFAL RYRARKYQSE       120
     QFRLPCSGLR GMRASLIPHQ LHIARDVGQR HAPRVLLADE VGLGKTIEAG MIIHQQLLSG       180
     RAERVLIVVP ETLQHQWLVE MLRRFNLRVA LFDDERYAEA AQDSSNPFET EQLVICSLDF       240
     VRRSRQRLEQ LADASWDLLV VDEAHHLAWS EQAPSREYQV IEQLAEQIPG VLLLTATPEQ       300
     LGQESHFARL RLLDPNRFHD YAQFVAEQLR YRPVADAVTL LLNDGHLQQD ELNMLCEMVA       360
     EQDIEPLLKA ANTDGEDSQQ ARAELVRMLM DRHGTSRVLF RNTRQGVKGF PQRTLHQITL       420
     PLPAQYQTAI KVSGIMGSKK SVEAQANDML YPERIYQEFE GENATWWNFD PRAEWLLDFL       480
     LTQRDEKVLV ICAQAATAIH LEQLLREREG IRAAVFHQGM SLIERDRAAA YFASQEEGAQ       540
     VLLCSEIGSE GRNFQFANHL VMFDLPFNPD LLEQRIGRLD RIGQARDIQI YVPCLEGTAQ       600
     SVLIRWYHQG LDAFEHTCPT GRTIYDRYYE TLLAFLAKPA QLDGFDDFIK TCRTDHDTLK       660
     IQLEKGRDRL LEMHSNGGEA AQALAGSIAA QDNDVNLVNF ALNLFDIVGI NQEDRSDSLI       720
     VLTPSDHMLV PDFPGLPQDG CTVTFDREQA LSREDAQFIS WEHPLMRNGL DLILSGDTGS       780
     SAVSLLKNKA LPVGTLLLEA VYVVEAQAPK QLQLTRFLPP TPVRMLLDAK GNDLAAQVEF       840
     ESFNRQLNAV NRHTASKLVN AVQPNVHAML QSGEALIADQ AQALIDAAKR EADEALSAEL       900
     ARLESLRAVN PNIRDDELET LEFTRRKVLE TLDQAGWRLD ALRLIVVSHQ                  950
//

If you have problems or comments...

PBIL Back to PBIL home page